Post

I Prefer Going Out For Breakfast With My Partner To Dinner

Sometimes it just feels more romantic 6 People

    Wetherspoons :)

    Sometimes on lazy mornings, me and my partner like to go to wetherspoons for breakfast. If we're staying with friends in another city, we ALWAYS do it! We cuddle up on one of their sofas, all sleepy and hungover, and we order the biggest fry up ever. Then we chat over breakfast...
    RedDaisy RedDaisy 22-25, F Jan 28, 2010

    Your Response

    Cancel

    I Prefer

    Going out for breakfast is something I miss doing.  I haven't gone for breakfast nor a brunch in a long while.  I also prefer going out in the morning then for dinner.
    Whateverrrrr Whateverrrrr 36-40, F Aug 19, 2011

    Your Response

    Cancel

    Related Experiences

    Going out to eat with family at Carrabbas as a Special Birthday Dinner since my birthday was on Wednesday and dad and sister were working so this is going to be a fun night...
    SoulWriter17 SoulWriter17 16-17, M 21 hrs ago

    Your Response

    Cancel
    I am 29 y/o Australian Chinese gay guy living in Sydney. Due to family pressure, I am hoping to find an Asian or Caucasian lesbian (preferably in Sydney) for marriage of...
    ttat1cn ttat1cn 26-30, M 3 days ago

    Your Response

    Cancel
    Being at home is where I feel the most comfortable. My Mum is mostly against this, but she's also somewhat happy about this me staying inside as I'm not "In some park smoking...
    KMargatroid KMargatroid 16-17, F Jul 7

    Your Response

    Cancel
    Going out to a water park :)
    Angel2345 Angel2345 13-15, F 1 Response 4 days ago

    Your Response

    Cancel
    Hello, I am going through a divorce with my husband whom I still love. How do you get through this?
    biggirl47 biggirl47 46-50, F 1 Response 5 days ago

    Your Response

    Cancel
    I'm not cared about. I'm a foriegner, it's ok to be beaten and held against your will as long as, she's a foriegner and it's your ''wife'' I screamed to the top of my lungs...
    Luckycharm2014 Luckycharm2014 18-21, F 2 Responses a week ago

    Your Response

    Cancel
    I'd cook you a nice dinner and pour you a glass of white wine. I'd enjoy listening to you converse while your eyes look into mine.I'd serve you dessert and some coffee or milk,I'd...
    bignatbreastluver bignatbreastluver 46-50, M 4 hrs ago

    Your Response

    Cancel
    I am definitely interested in LaVeyan Satanism. It takes atheism to a whole new level and provides a creed and a model for living that everyone can benefit from. The only problem...
    gayin98 gayin98 16-17, M 2 Responses Jul 4

    Your Response

    Cancel
    I think I work best when I have an audience, or someone to show off for. When writing just by myself with no input, my motivation tends to be lacking.
    socalwriter socalwriter 31-35, M Jul 6

    Your Response

    Cancel
    I'm looking for an online girlfriend, married or not , from 30 yrs up who is interested in an online man for a relationship to "chat" with . If you're interested plz send me a...
    boxersoff4u boxersoff4u 51-55, M Jul 8

    Your Response

    Cancel
    I do enjoy being with female friends. I relate so much better with females, then males, I connect better with them. I can carry on a conversation so much better with women then men...
    DawnR59 DawnR59 51-55, T 5 days ago

    Your Response

    Cancel
    Do i like getting out?: Yes i do enjoy being outside, I like to hike,swim, go camping, and run. but when i get out, i am outside training.I'm not one to go to a party or a dance...
    addictedtoweightlifting addictedtoweightlifting 18-21, M Jul 7

    Your Response

    Cancel
    I would rather stay at home then go out. It is peaceful at home and there is usually nobody to bother you. Then again, I do not have much time to go out. The life of a teacher is a...
    Wattouat Wattouat 18-21, F 1 Response Jul 6

    Your Response

    Cancel
    It depends, actually. When I always stay home, I find that I won't feel the drive to go out. But if I go out, it will almost seem like I don't have a proper home. haha! It all...
    malipatient malipatient 26-30, F 2 Responses Jul 16

    Your Response

    Cancel
    I like relaxing , after working everyday, I enjoy having time to myself , i always have liked being home even when I was in my 20's . I do enjoy Goin out sometimes it's nice if I...
    uniqeuliv uniqeuliv 31-35, F 2 Responses Jul 16

    Your Response

    Cancel
    I'm not much of a people's person . I'd rather be home eating and watching pretty little liars then go out and be someone I'm not.
    emoniemm emoniemm 13-15, F 3 Responses Jul 16

    Your Response

    Cancel
    Sometimes staying in alone can be the best decision, that way not only do you save money but you save yourself the hassle of trying to find a way home, or bumping into someone you...
    Anth1290 Anth1290 22-25, M Jul 17

    Your Response

    Cancel
    Staying at home on a rainy day watching movies and cuddling on the sofa, with a lot of junk food...best lazy day ever.
    Daisymay77 Daisymay77 16-17, F 1 Response Jul 17

    Your Response

    Cancel
    Why would I go out when all my friends are right here? Why use up energy when I can lay down and relax? I spend so so much time home alone anyway, so Imma used to it :P
    InternationalDarkness InternationalDarkness 13-15, F 3 Responses a week ago

    Your Response

    Cancel
    Once again I feel this longing in life that I need to do something new or I have not tried yet. So I decided beach tennis or stand up paddling. One is easier then the other but...
    rukesh3 rukesh3 18-21, F 1 Response 3 days ago

    Your Response

    Cancel
    I do. These days there is such a variety of food available it's wonderful. I don't mind eating alone but it's far more enjoyable if there are others with you.
    picklebobble picklebobble 46-50, M 12 hrs ago

    Your Response

    Cancel
    Some things change as you get a little older. Your choice of "fun" definitely alters from your teens to your 20's, and again from your 20's to your 30's. Now that I'm in my 40's...
    Beaver318 Beaver318 41-45, M 2 Responses Jul 1

    Your Response

    Cancel
    Yep, that what I did for a while.
    wt00r wt00r 26-30, M Jul 7

    Your Response

    Cancel
    Well a year has come and it has also passed , since I've found out my wife was having an affair , yes we talked and tried to make it through everything together but a lot can and...
    juniorjohn juniorjohn 31-35 Jul 12

    Your Response

    Cancel
    hey all ! ... this is important and big. can i have a small time of yours, just little.. few minutes.. i sign up here around a year back to share my story with people and i did. i...
    heartless2 heartless2 22-25, M 2 Responses 4 days ago

    Your Response

    Cancel
    I find it pointless and expensive when you just hang out with friends almost all the time for the mere sake of it and not because you want to enjoy a special activity and instant...
    psycopower90 psycopower90 22-25, M 3 days ago

    Your Response

    Cancel
    Just this past weekend, my wife & I were in Las Vegas by ourselves. I noticed a cute dress in the window of Lane Bryant and we decided to see if they had the right size at the...
    nikkifemmdslave2 nikkifemmdslave2 36-40, M 5 Responses Jul 17

    Your Response

    Cancel
    In addition to the thrill of feeling all of the silky, lacy and stylish textures that you get to experience in shopping for female garb, I love getting to discuss the styles and...
    DonnaSue10 DonnaSue10 66-70, M 2 Responses Jul 17

    Your Response

    Cancel
    So last year I was at the movies with kris my boyfriend and there were some annoying people with kids next to us and me and kris started making out then they were like let's go ok...
    Stephanie128 Stephanie128 16-17, F 2 Responses 2 days ago

    Your Response

    Cancel
    I have so much pent up anger that the smallest thing will set me off, and the next thing I know I am shaking and in tears because I am just SO ******* ANGRY!!! I don't know what to...
    Schozophrenia Schozophrenia 18-21, F 1 Response Jul 6

    Your Response

    Cancel
    I really do! I have a disability myself and so I know exactly what it's like and how hard it is in a society we live in today... I know how horrible the struggles are and the...
    MilweePetite MilweePetite 18-21, F 2 Responses Jul 13

    Your Response

    Cancel
    uk female friend needed 18+ im a guy in my 30 s looking for a female friend to get to know then enjoy benefits with . any girls out there wanting this ?
    rodwood rodwood 31-35, M 1 Response 4 days ago

    Your Response

    Cancel
    Any women looking for FWB Message me don't worry about age I'll work it out when you message me
    ryanmona ryanmona 18-21, M 4 days ago

    Your Response

    Cancel
    Lolking for curvy fem nw uk pm me
    pauly672 pauly672 46-50, M Jul 3

    Your Response

    Cancel
    For the last five years mum has been doin race for life, its a kinda race over 5km that ladies do (men can join in buh its mostly ladies) an its to raise money for cancer charities...
    hanntiger1 hanntiger1 18-21, F 4 Responses Jul 8

    Your Response

    Cancel
    It's hard living with HIV especially if you in North America, it's hard finding someone that will love you with HIV! Sometimes I wanna give up on dating but I get very lonely...
    blackmodel blackmodel 31-35, F 2 Responses Jul 9

    Your Response

    Cancel
    Female friend wanted. Up for anything. If interested add and message.
    oneperson93 oneperson93 18-21, M Jul 13

    Your Response

    Cancel
    I am male 55 from the UK looking for female friends with benefits some one who enjoys chatting on cam and flirting to we get sexually aroused
    tomisgod tomisgod 46-50, M Jul 14

    Your Response

    Cancel
    Taco Bell!!!!!!!!!!!!!!!!!!!
    bela5562 bela5562 13-15, F 11 hrs ago

    Your Response

    Cancel
    I can scream as loud as i want 10/10
    L00kas L00kas 13-15, M 1 Response 3 hrs ago

    Your Response

    Cancel
    When I'm alone I'm allowed to be nudee and its fascinating what I can do
    TradLesbiNude TradLesbiNude 18-21, F 2 Responses 3 hrs ago

    Your Response

    Cancel
    Good protein and no fat. Tastes pretty good when you are hungry.
    Iyaha Iyaha 56-60, F 1 Response Jun 30

    Your Response

    Cancel
    It's so delicious. I love fried dumplings, festival, ackee, and fish.
    MAROONTRIBE MAROONTRIBE 41-45, M 2 Responses a week ago

    Your Response

    Cancel
    Keldkgkeqnskfkdhabqdmvkkqlvlckwngkvkwktwdkckfmgkkenvjhwjwkckakwnfkovoahemekckchsnefmlglyoshwbrkvskwbdnckajwnekgigjylekwmelvksanwmkcajlsoawornglwoqichxjanfmblsoekclskejtkfkgkjewnrkk...
    KylieLaine KylieLaine 18-21, F 3 Responses 2 days ago

    Your Response

    Cancel
    Your eating a rapper?😂😂😂 I think you mean M&M's 😂😂😂
    ImNotOkayWhyCantYouSeeThat ImNotOkayWhyCantYouSeeThat 13-15, F 2 days ago